| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein) new dimerisation mode with swapping of C-terminal helices |
| Protein Prephenate dehydrogenase TyrA [140781] (3 species) |
| Species Aquifex aeolicus [TaxId:63363] [140782] (1 PDB entry) Uniprot O67636 201-310 |
| Domain d2g5cb1: 2g5c B:201-310 [134648] Other proteins in same PDB: d2g5ca2, d2g5cb2, d2g5cc2, d2g5cd2 automated match to d2g5ca1 complexed with nad |
PDB Entry: 2g5c (more details), 1.9 Å
SCOPe Domain Sequences for d2g5cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g5cb1 a.100.1.12 (B:201-310) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}
spelhdyvfgvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwr
diflenkenvmkaiegfekslnhlkelivreaeeelveylkevkikrmei
Timeline for d2g5cb1: