Lineage for d2g55a_ (2g55 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2405567Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
    Uniprot P00760
  8. 2405787Domain d2g55a_: 2g55 A: [134644]
    automated match to d1aq7__
    complexed with ca, cl

Details for d2g55a_

PDB Entry: 2g55 (more details), 1.82 Å

PDB Description: Anomalous substructure of trypsin (P3121)
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d2g55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g55a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2g55a_:

Click to download the PDB-style file with coordinates for d2g55a_.
(The format of our PDB-style files is described here.)

Timeline for d2g55a_: