SCOPe 2.06: Domain d2g51a_: 2g51 A:

Lineage for d2g51a_ (2g51 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)

8. Domain d2g51a_: 2g51 A: [134642]
   automated match to d1fn8a_
   complexed with cl

Details for d2g51a_

PDB Entry: 2g51, 1.84 Å

PDB Description: anomalous substructure of trypsin (p1)

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d2g51a_:

Sequence; same for both SEQRES and ATOM records:

>d2g51a_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

Timeline for d2g51a_:

• d2g51a_ first appeared in SCOP 1.73, called d2g51a1
  
• d2g51a_ appears in SCOPe 2.05
  
• d2g51a_ appears in SCOPe 2.07
  
• d2g51a_ appears in the current release, SCOPe 2.08