Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries) |
Domain d2g50b3: 2g50 B:396-530 [134623] Other proteins in same PDB: d2g50a1, d2g50a2, d2g50b1, d2g50b2, d2g50c1, d2g50c2, d2g50d1, d2g50d2, d2g50e1, d2g50e2, d2g50f1, d2g50f2, d2g50g1, d2g50g2, d2g50h1, d2g50h2 automatically matched to d1a49a3 complexed with ala, edo, ete, gol, k, mn, na, pyr |
PDB Entry: 2g50 (more details), 1.65 Å
SCOPe Domain Sequences for d2g50b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g50b3 c.49.1.1 (B:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} elarassqstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr pgsgftntmrvvpvp
Timeline for d2g50b3: