Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
Protein Thermolysin [63414] (3 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries) Uniprot P00800 |
Domain d2g4za_: 2g4z A: [134617] automated match to d2tlxa_ complexed with ca, cl, so4, zn |
PDB Entry: 2g4z (more details), 1.98 Å
SCOPe Domain Sequences for d2g4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4za_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]} itgtstvgvgrgvlgdqkninttystyyylqdntrgdgiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsem vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d2g4za_: