SCOPe 2.07: Domain d2g4xa_: 2g4x A:

Lineage for d2g4xa_ (2g4x A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d2g4xa_: 2g4x A: [134615]
   automated match to d1a2wa_
   complexed with cl, so4

Details for d2g4xa_

PDB Entry: 2g4x, 1.95 Å

PDB Description: Anomalous substructure od ribonuclease A (P3221)

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2g4xa_:

Sequence; same for both SEQRES and ATOM records:

>d2g4xa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2g4xa_:

• d2g4xa_ first appeared in SCOP 1.73, called d2g4xa1
  
• d2g4xa_ appears in SCOPe 2.06
  
• d2g4xa_ appears in the current release, SCOPe 2.08