Lineage for d2g4va1 (2g4v A:1-279)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698065Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 698066Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 698067Family c.41.1.1: Subtilases [52744] (13 proteins)
  6. 698105Protein Proteinase K [52762] (1 species)
  7. 698106Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (25 PDB entries)
  8. 698122Domain d2g4va1: 2g4v A:1-279 [134612]
    automatically matched to d1ic6a_
    complexed with ca, cl, k

Details for d2g4va1

PDB Entry: 2g4v (more details), 2.14 Å

PDB Description: anomalous substructure of proteinase K
PDB Compounds: (A:) Proteinase K

SCOP Domain Sequences for d2g4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4va1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOP Domain Coordinates for d2g4va1:

Click to download the PDB-style file with coordinates for d2g4va1.
(The format of our PDB-style files is described here.)

Timeline for d2g4va1: