SCOP 1.75: Domain d2g4ua1: 2g4u A:1-240

Lineage for d2g4ua1 (2g4u A:1-240)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (94 PDB entries)

8. Domain d2g4ua1: 2g4u A:1-240 [134611]
   automatically matched to d1c1ma_
   complexed with ca, flc

Details for d2g4ua1

PDB Entry: 2g4u, 1.84 Å

PDB Description: Anomalous substructure of porcine pancreatic elastaase (Ca)

PDB Compounds: (A:) Elastase-1

SCOP Domain Sequences for d2g4ua1:

Sequence; same for both SEQRES and ATOM records:

>d2g4ua1 b.47.1.2 (A:1-240) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2g4ua1:

• d2g4ua1 first appeared in SCOP 1.73
  
• d2g4ua1 is called d2g4ua_ in SCOPe 2.01
  
• d2g4ua1 appears in the current release, SCOPe 2.08, called d2g4ua_