Lineage for d2g4nc_ (2g4n C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2532723Protein automated matches [190299] (8 species)
    not a true protein
  7. 2532764Species Cow (Bos taurus) [TaxId:9913] [187106] (2 PDB entries)
  8. 2532768Domain d2g4nc_: 2g4n C: [134600]
    automated match to d1f6ra_
    complexed with ca, k

Details for d2g4nc_

PDB Entry: 2g4n (more details), 2.3 Å

PDB Description: Anomalous substructure of alpha-lactalbumin
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d2g4nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4nc_ d.2.1.2 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
ek

SCOPe Domain Coordinates for d2g4nc_:

Click to download the PDB-style file with coordinates for d2g4nc_.
(The format of our PDB-style files is described here.)

Timeline for d2g4nc_: