Lineage for d2g4nc1 (2g4n C:1-122)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714023Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 714024Species Cow (Bos taurus) [TaxId:9913] [53980] (4 PDB entries)
  8. 714043Domain d2g4nc1: 2g4n C:1-122 [134600]
    automatically matched to d1f6ra_
    complexed with ca, k

Details for d2g4nc1

PDB Entry: 2g4n (more details), 2.3 Å

PDB Description: Anomalous substructure of alpha-lactalbumin
PDB Compounds: (C:) alpha-lactalbumin

SCOP Domain Sequences for d2g4nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4nc1 d.2.1.2 (C:1-122) alpha-Lactalbumin {Cow (Bos taurus) [TaxId: 9913]}
eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
ek

SCOP Domain Coordinates for d2g4nc1:

Click to download the PDB-style file with coordinates for d2g4nc1.
(The format of our PDB-style files is described here.)

Timeline for d2g4nc1: