Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein automated matches [190299] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187106] (2 PDB entries) |
Domain d2g4na_: 2g4n A: [134598] automated match to d1f6ra_ complexed with ca, k |
PDB Entry: 2g4n (more details), 2.3 Å
SCOPe Domain Sequences for d2g4na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4na_ d.2.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc ek
Timeline for d2g4na_: