SCOPe 2.04: Domain d2g4na_: 2g4n A:

Lineage for d2g4na_ (2g4n A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187106] (2 PDB entries)

8. Domain d2g4na_: 2g4n A: [134598]
   automated match to d1f6ra_
   complexed with ca, k

Details for d2g4na_

PDB Entry: 2g4n, 2.3 Å

PDB Description: Anomalous substructure of alpha-lactalbumin

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d2g4na_:

Sequence; same for both SEQRES and ATOM records:

>d2g4na_ d.2.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
ek

Timeline for d2g4na_:

• d2g4na_ first appeared in SCOP 1.73, called d2g4na1
  
• d2g4na_ appears in SCOPe 2.03
  
• d2g4na_ appears in SCOPe 2.05
  
• d2g4na_ appears in the current release, SCOPe 2.08