![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
![]() | Family c.1.15.3: Xylose isomerase [51665] (2 proteins) |
![]() | Protein automated matches [190298] (3 species) not a true protein |
![]() | Species Streptomyces rubiginosus [TaxId:1929] [187248] (20 PDB entries) |
![]() | Domain d2g4ja_: 2g4j A: [134596] automated match to d1clka_ complexed with ca, cl, mg |
PDB Entry: 2g4j (more details), 1.85 Å
SCOPe Domain Sequences for d2g4ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4ja_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]} nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd vdaaaargmaferldqlamdhllgar
Timeline for d2g4ja_: