Lineage for d2g4ja_ (2g4j A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839349Protein automated matches [190298] (3 species)
    not a true protein
  7. 2839359Species Streptomyces rubiginosus [TaxId:1929] [187248] (20 PDB entries)
  8. 2839370Domain d2g4ja_: 2g4j A: [134596]
    automated match to d1clka_
    complexed with ca, cl, mg

Details for d2g4ja_

PDB Entry: 2g4j (more details), 1.85 Å

PDB Description: Anomalous substructure of Glucose isomerase
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d2g4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4ja_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d2g4ja_:

Click to download the PDB-style file with coordinates for d2g4ja_.
(The format of our PDB-style files is described here.)

Timeline for d2g4ja_: