SCOPe 2.08: Domain d2g4ia_: 2g4i A:

Lineage for d2g4ia_ (2g4i A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (4 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Canavalia virosa [TaxId:28958] [186936] (3 PDB entries)

8. Domain d2g4ia_: 2g4i A: [134595]
   automated match to d1apna_
   complexed with ca, cl, mn, na

Details for d2g4ia_

PDB Entry: 2g4i, 2.4 Å

PDB Description: Anomalous substructure of Concanavalin A

PDB Compounds: (A:) concanavalin a

SCOPe Domain Sequences for d2g4ia_:

Sequence; same for both SEQRES and ATOM records:

>d2g4ia_ b.29.1.1 (A:) Concanavalin A {Canavalia virosa [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d2g4ia_:

• d2g4ia_ first appeared in SCOP 1.73, called d2g4ia1
  
• d2g4ia_ appears in SCOPe 2.07