Lineage for d2g4ha1 (2g4h A:6-175)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766021Protein (Apo)ferritin [47246] (7 species)
  7. 766079Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (20 PDB entries)
  8. 766089Domain d2g4ha1: 2g4h A:6-175 [134594]
    automatically matched to d1dat__
    complexed with cd, cl

Details for d2g4ha1

PDB Entry: 2g4h (more details), 2 Å

PDB Description: Anomalous substructure of apoferritin
PDB Compounds: (A:) ferritin light chain

SCOP Domain Sequences for d2g4ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4ha1 a.25.1.1 (A:6-175) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOP Domain Coordinates for d2g4ha1:

Click to download the PDB-style file with coordinates for d2g4ha1.
(The format of our PDB-style files is described here.)

Timeline for d2g4ha1: