Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein (Apo)ferritin [47246] (7 species) |
Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (20 PDB entries) |
Domain d2g4ha1: 2g4h A:6-175 [134594] automatically matched to d1dat__ complexed with cd, cl |
PDB Entry: 2g4h (more details), 2 Å
SCOP Domain Sequences for d2g4ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4ha1 a.25.1.1 (A:6-175) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]} sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl
Timeline for d2g4ha1: