Lineage for d2g4cc1 (2g4c C:369-485)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170330Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1170331Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) (S)
  5. 1170332Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 1170402Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)
  7. 1170403Species Human (Homo sapiens) [TaxId:9606] [142419] (1 PDB entry)
    Uniprot Q9UHN1 369-485
  8. 1170406Domain d2g4cc1: 2g4c C:369-485 [134586]
    Other proteins in same PDB: d2g4ca2, d2g4cb2, d2g4cc2, d2g4cd2
    automatically matched to 2G4C A:369-485

Details for d2g4cc1

PDB Entry: 2g4c (more details), 3.15 Å

PDB Description: crystal structure of human dna polymerase gamma accessory subunit
PDB Compounds: (C:) DNA polymerase gamma subunit 2

SCOPe Domain Sequences for d2g4cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4cc1 c.51.1.1 (C:369-485) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletmqssleql
yskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyissaknv

SCOPe Domain Coordinates for d2g4cc1:

Click to download the PDB-style file with coordinates for d2g4cc1.
(The format of our PDB-style files is described here.)

Timeline for d2g4cc1: