Lineage for d2g4ca1 (2g4c A:369-485)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2135876Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2135877Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2135947Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)
  7. 2135948Species Human (Homo sapiens) [TaxId:9606] [142419] (2 PDB entries)
    Uniprot Q9UHN1 369-485
  8. 2135949Domain d2g4ca1: 2g4c A:369-485 [134582]
    Other proteins in same PDB: d2g4ca2, d2g4cb2, d2g4cc2, d2g4cd2

Details for d2g4ca1

PDB Entry: 2g4c (more details), 3.15 Å

PDB Description: crystal structure of human dna polymerase gamma accessory subunit
PDB Compounds: (A:) DNA polymerase gamma subunit 2

SCOPe Domain Sequences for d2g4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4ca1 c.51.1.1 (A:369-485) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletmqssleql
yskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyissaknv

SCOPe Domain Coordinates for d2g4ca1:

Click to download the PDB-style file with coordinates for d2g4ca1.
(The format of our PDB-style files is described here.)

Timeline for d2g4ca1: