Lineage for d2g46b_ (2g46 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427940Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2427982Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
    consists of SET domain only; dimeric
  6. 2427983Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)
  7. 2427984Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (5 PDB entries)
  8. 2427992Domain d2g46b_: 2g46 B: [134581]
    automated match to d3kmta_
    complexed with sah

Details for d2g46b_

PDB Entry: 2g46 (more details)

PDB Description: structure of vset in complex with mek27 h3 pept. and cofactor product sah
PDB Compounds: (B:) PBCV-1 histone H3-Lys 27 methyltransferase

SCOPe Domain Sequences for d2g46b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g46b_ b.85.7.2 (B:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

SCOPe Domain Coordinates for d2g46b_:

Click to download the PDB-style file with coordinates for d2g46b_.
(The format of our PDB-style files is described here.)

Timeline for d2g46b_: