SCOPe 2.03: Domain d2g46a1: 2g46 A:1-119

Lineage for d2g46a1 (2g46 A:1-119)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
   consists of SET domain only; dimeric

6. Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)

7. Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (5 PDB entries)

8. Domain d2g46a1: 2g46 A:1-119 [134580]
   automatically matched to d1n3ja_
   complexed with sah

Details for d2g46a1

PDB Entry: 2g46

PDB Description: structure of vset in complex with mek27 h3 pept. and cofactor product sah

PDB Compounds: (A:) PBCV-1 histone H3-Lys 27 methyltransferase

SCOPe Domain Sequences for d2g46a1:

Sequence; same for both SEQRES and ATOM records:

>d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

Timeline for d2g46a1:

• d2g46a1 first appeared in SCOP 1.73
  
• d2g46a1 appears in SCOPe 2.02
  
• d2g46a1 is called d2g46a_ in SCOPe 2.04
  
• d2g46a1 appears in the current release, SCOPe 2.08, called d2g46a_