Lineage for d2g46a1 (2g46 A:1-119)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811316Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 811343Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
    consists of SET domain only; dimeric
  6. 811344Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)
  7. 811345Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (2 PDB entries)
  8. 811346Domain d2g46a1: 2g46 A:1-119 [134580]
    automatically matched to d1n3ja_
    complexed with mlz, sah

Details for d2g46a1

PDB Entry: 2g46 (more details)

PDB Description: structure of vset in complex with mek27 h3 pept. and cofactor product sah
PDB Compounds: (A:) PBCV-1 histone H3-Lys 27 methyltransferase

SCOP Domain Sequences for d2g46a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

SCOP Domain Coordinates for d2g46a1:

Click to download the PDB-style file with coordinates for d2g46a1.
(The format of our PDB-style files is described here.)

Timeline for d2g46a1: