![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.7: SET domain [82199] (4 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core Pfam PF00856 |
![]() | Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein) consists of SET domain only; dimeric |
![]() | Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species) |
![]() | Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (5 PDB entries) |
![]() | Domain d2g46a_: 2g46 A: [134580] automated match to d3kmta_ complexed with sah |
PDB Entry: 2g46 (more details)
SCOPe Domain Sequences for d2g46a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g46a_ b.85.7.2 (A:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
Timeline for d2g46a_: