Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein GTP-binding protein GEM [142289] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142290] (2 PDB entries) Uniprot P55040 73-244 |
Domain d2g3ya1: 2g3y A:73-244 [134574] complexed with gdp |
PDB Entry: 2g3y (more details), 2.4 Å
SCOPe Domain Sequences for d2g3ya1:
Sequence, based on SEQRES records: (download)
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} ntyyrvvligeqgvgkstlanifagvhdsmdsdcevlgedtyertlmvdgesatiilldm wenkgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnk sdlvrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrd
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} ntyyrvvligeqgvgkstlanifagvhdsmdsdlgedtyertlmvdgesatiilldmwen kgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdl vrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrd
Timeline for d2g3ya1: