Lineage for d2g3ya1 (2g3y A:73-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867219Protein GTP-binding protein GEM [142289] (1 species)
  7. 2867220Species Human (Homo sapiens) [TaxId:9606] [142290] (2 PDB entries)
    Uniprot P55040 73-244
  8. 2867221Domain d2g3ya1: 2g3y A:73-244 [134574]
    complexed with gdp

Details for d2g3ya1

PDB Entry: 2g3y (more details), 2.4 Å

PDB Description: Crystal structure of the human small GTPase GEM
PDB Compounds: (A:) GTP-binding protein gem

SCOPe Domain Sequences for d2g3ya1:

Sequence, based on SEQRES records: (download)

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}
ntyyrvvligeqgvgkstlanifagvhdsmdsdcevlgedtyertlmvdgesatiilldm
wenkgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnk
sdlvrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrd

Sequence, based on observed residues (ATOM records): (download)

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}
ntyyrvvligeqgvgkstlanifagvhdsmdsdlgedtyertlmvdgesatiilldmwen
kgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdl
vrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrd

SCOPe Domain Coordinates for d2g3ya1:

Click to download the PDB-style file with coordinates for d2g3ya1.
(The format of our PDB-style files is described here.)

Timeline for d2g3ya1: