SCOP 1.73: Domain d2g3kf1: 2g3k F:148-241

Lineage for d2g3kf1 (2g3k F:148-241)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (1 family)

5. Family a.24.28.1: VPS28 C-terminal domain-like [140428] (1 protein)
   C-terminal part of Pfam PF03997

6. Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (3 PDB entries)

8. Domain d2g3kf1: 2g3k F:148-241 [134567]
   automatically matched to 2G3K A:148-241

Details for d2g3kf1

PDB Entry: 2g3k, 3.05 Å

PDB Description: Crystal structure of the C-terminal domain of Vps28

PDB Compounds: (F:) vacuolar protein sorting-associated protein vps28

SCOP Domain Sequences for d2g3kf1:

Sequence; same for both SEQRES and ATOM records:

>d2g3kf1 a.24.28.1 (F:148-241) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
rinklsigdtltetqirellfdlelayksfyall

Timeline for d2g3kf1:

• d2g3kf1 is new in SCOP 1.73
  
• d2g3kf1 appears in SCOP 1.75
  
• d2g3kf1 appears in the current release, SCOPe 2.08, called d2g3kf_