Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) |
Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins) C-terminal part of Pfam PF03997 |
Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (1 PDB entry) Uniprot Q02767 148-241 |
Domain d2g3kd_: 2g3k D: [134565] automated match to d2j9va_ |
PDB Entry: 2g3k (more details), 3.05 Å
SCOPe Domain Sequences for d2g3kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3kd_ a.24.28.1 (D:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv rinklsigdtltetqirellfdlelayksfyall
Timeline for d2g3kd_: