SCOPe 2.08: Domain d2g3kc_: 2g3k C:

Lineage for d2g3kc_ (2g3k C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families)

5. Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins)
   C-terminal part of Pfam PF03997

6. Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (1 PDB entry)
   Uniprot Q02767 148-241

8. Domain d2g3kc_: 2g3k C: [134564]
   automated match to d2j9va_

Details for d2g3kc_

PDB Entry: 2g3k, 3.05 Å

PDB Description: Crystal structure of the C-terminal domain of Vps28

PDB Compounds: (C:) vacuolar protein sorting-associated protein vps28

SCOPe Domain Sequences for d2g3kc_:

Sequence; same for both SEQRES and ATOM records:

>d2g3kc_ a.24.28.1 (C:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
rinklsigdtltetqirellfdlelayksfyall

Timeline for d2g3kc_:

• d2g3kc_ first appeared in SCOP 1.73, called d2g3kc1
  
• d2g3kc_ appears in SCOPe 2.07