![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) ![]() |
![]() | Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins) C-terminal part of Pfam PF03997 |
![]() | Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (1 PDB entry) Uniprot Q02767 148-241 |
![]() | Domain d2g3kc_: 2g3k C: [134564] automated match to d2j9va_ |
PDB Entry: 2g3k (more details), 3.05 Å
SCOPe Domain Sequences for d2g3kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3kc_ a.24.28.1 (C:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv rinklsigdtltetqirellfdlelayksfyall
Timeline for d2g3kc_: