Lineage for d2g3kb_ (2g3k B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700773Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) (S)
  5. 2700774Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins)
    C-terminal part of Pfam PF03997
  6. 2700775Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species)
  7. 2700776Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (1 PDB entry)
    Uniprot Q02767 148-241
  8. 2700778Domain d2g3kb_: 2g3k B: [134563]
    automated match to d2j9va_

Details for d2g3kb_

PDB Entry: 2g3k (more details), 3.05 Å

PDB Description: Crystal structure of the C-terminal domain of Vps28
PDB Compounds: (B:) vacuolar protein sorting-associated protein vps28

SCOPe Domain Sequences for d2g3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3kb_ a.24.28.1 (B:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
rinklsigdtltetqirellfdlelayksfyall

SCOPe Domain Coordinates for d2g3kb_:

Click to download the PDB-style file with coordinates for d2g3kb_.
(The format of our PDB-style files is described here.)

Timeline for d2g3kb_: