![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Putative transcriptional regulator [140909] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [140910] (1 PDB entry) |
![]() | Domain d2g3bb2: 2g3b B:74-189 [134561] Other proteins in same PDB: d2g3ba1, d2g3bb1 automated match to d2g3ba2 complexed with gol |
PDB Entry: 2g3b (more details), 2 Å
SCOPe Domain Sequences for d2g3bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3bb2 a.121.1.1 (B:74-189) Putative transcriptional regulator {Rhodococcus sp. RHA1 [TaxId: 101510]} dsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplarttaawvseiadai vqaqatgeisrsldpqptavtmtalveglsgrwlckeistedarshllgaidvvms
Timeline for d2g3bb2: