![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
![]() | Protein Probable acetyltransferase Atu2258 [143656] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [143657] (1 PDB entry) |
![]() | Domain d2g3aa1: 2g3a A:1-137 [134557] |
PDB Entry: 2g3a (more details), 1.9 Å
SCOP Domain Sequences for d2g3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} mnfvlsdvadaeaekairdplvaynlarfgesdkrdlnitirnddnsvtgglvghtargw lyvqllfvpeamrgqgiapkllamaeeearkrgcmgayidtmnpdalrtyerygftkigs lgplssgqsitwlekrf
Timeline for d2g3aa1: