Lineage for d2g3aa1 (2g3a A:1-137)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533426Protein Probable acetyltransferase Atu2258 [143656] (1 species)
  7. 2533427Species Agrobacterium tumefaciens [TaxId:358] [143657] (1 PDB entry)
    Uniprot Q7CXI0 1-137
  8. 2533428Domain d2g3aa1: 2g3a A:1-137 [134557]

Details for d2g3aa1

PDB Entry: 2g3a (more details), 1.9 Å

PDB Description: Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens
PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d2g3aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]}
mnfvlsdvadaeaekairdplvaynlarfgesdkrdlnitirnddnsvtgglvghtargw
lyvqllfvpeamrgqgiapkllamaeeearkrgcmgayidtmnpdalrtyerygftkigs
lgplssgqsitwlekrf

SCOPe Domain Coordinates for d2g3aa1:

Click to download the PDB-style file with coordinates for d2g3aa1.
(The format of our PDB-style files is described here.)

Timeline for d2g3aa1: