Lineage for d2g39a1 (2g39 A:3-223)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922354Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 2922359Protein Acetyl-CoA hydrolase (PA5445) [142196] (1 species)
    duplication: consists of two topologically similar domains; overall similarity to CitF2
  7. 2922360Species Pseudomonas aeruginosa [TaxId:287] [142197] (1 PDB entry)
    Uniprot Q9HTC2 224-497! Uniprot Q9HTC2 3-223
  8. 2922361Domain d2g39a1: 2g39 A:3-223 [134553]
    complexed with acy, edo

Details for d2g39a1

PDB Entry: 2g39 (more details), 2.1 Å

PDB Description: Crystal structure of coenzyme A transferase from Pseudomonas aeruginosa
PDB Compounds: (A:) Acetyl-CoA hydrolase

SCOPe Domain Sequences for d2g39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g39a1 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]}
rdrvrlpslldkvmsaaeaadliqdgmtvgmsgftrageakavpqalamrakerplrisl
mtgaslgndldkqlteagvlarrmpfqvdstlrkainagevmfidqhlsetveqlrnhql
klpdiavieaaaiteqghivpttsvgnsasfaifakqviveinlahstnleglhdiyipt
yrptrtpipltrvddrigstaipippekivaivindqpdsp

SCOPe Domain Coordinates for d2g39a1:

Click to download the PDB-style file with coordinates for d2g39a1.
(The format of our PDB-style files is described here.)

Timeline for d2g39a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g39a2