SCOPe 2.08: Domain d2g38d_: 2g38 D:

Lineage for d2g38d_ (2g38 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.2: PPE [140463] (2 proteins)
   Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit

6. Protein PPE41 [140464] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140465] (3 PDB entries)
   Uniprot Q79FE1 2-174

8. Domain d2g38d_: 2g38 D: [134552]
   Other proteins in same PDB: d2g38a1, d2g38c_
   automated match to d2g38b1
   complexed with mn

Details for d2g38d_

PDB Entry: 2g38, 2.2 Å

PDB Description: a pe/ppe protein complex from mycobacterium tuberculosis

PDB Compounds: (D:) ppe family protein

SCOPe Domain Sequences for d2g38d_:

Sequence; same for both SEQRES and ATOM records:

>d2g38d_ a.25.4.2 (D:) PPE41 {Mycobacterium tuberculosis [TaxId: 1773]}
afeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpvv
mqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqilid
nnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia

Timeline for d2g38d_:

• d2g38d_ first appeared in SCOP 1.73, called d2g38d1
  
• d2g38d_ appears in SCOPe 2.07