Lineage for d2g38c_ (2g38 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318647Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle
  5. 2318648Family a.25.4.1: PE [140460] (2 proteins)
    Pfam PF00934; pairs with with the N-terminal hairpin of PPE
  6. 2318649Protein PE25 [140461] (1 species)
  7. 2318650Species Mycobacterium tuberculosis [TaxId:1773] [140462] (1 PDB entry)
    Uniprot Q7D756 8-84
  8. 2318652Domain d2g38c_: 2g38 C: [134551]
    Other proteins in same PDB: d2g38b1, d2g38d_
    automated match to d2g38a1
    complexed with mn

Details for d2g38c_

PDB Entry: 2g38 (more details), 2.2 Å

PDB Description: a pe/ppe protein complex from mycobacterium tuberculosis
PDB Compounds: (C:) pe family protein

SCOPe Domain Sequences for d2g38c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g38c_ a.25.4.1 (C:) PE25 {Mycobacterium tuberculosis [TaxId: 1773]}
pealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqtia
aaavvleefahalttg

SCOPe Domain Coordinates for d2g38c_:

Click to download the PDB-style file with coordinates for d2g38c_.
(The format of our PDB-style files is described here.)

Timeline for d2g38c_: