![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle |
![]() | Family a.25.4.1: PE [140460] (1 protein) Pfam PF00934; pairs with with the N-terminal hairpin of PPE |
![]() | Protein PE25 [140461] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [140462] (1 PDB entry) |
![]() | Domain d2g38c1: 2g38 C:8-83 [134551] Other proteins in same PDB: d2g38b1, d2g38d1 automatically matched to 2G38 A:8-84 complexed with mn; mutant |
PDB Entry: 2g38 (more details), 2.2 Å
SCOP Domain Sequences for d2g38c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g38c1 a.25.4.1 (C:8-83) PE25 {Mycobacterium tuberculosis [TaxId: 1773]} pealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqtia aaavvleefahalttg
Timeline for d2g38c1: