Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle |
Family a.25.4.1: PE [140460] (2 proteins) Pfam PF00934; pairs with with the N-terminal hairpin of PPE |
Protein PE25 [140461] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [140462] (1 PDB entry) Uniprot Q7D756 8-84 |
Domain d2g38c_: 2g38 C: [134551] Other proteins in same PDB: d2g38b1, d2g38d_ automated match to d2g38a1 complexed with mn |
PDB Entry: 2g38 (more details), 2.2 Å
SCOPe Domain Sequences for d2g38c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g38c_ a.25.4.1 (C:) PE25 {Mycobacterium tuberculosis [TaxId: 1773]} pealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqtia aaavvleefahalttg
Timeline for d2g38c_: