SCOP 1.73: Domain d2g38b1: 2g38 B:2-174

Lineage for d2g38b1 (2g38 B:2-174)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.2: PPE [140463] (1 protein)
   Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit

6. Protein PPE41 [140464] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140465] (1 PDB entry)

8. Domain d2g38b1: 2g38 B:2-174 [134550]
   Other proteins in same PDB: d2g38a1, d2g38c1
   complexed with mn; mutant

Details for d2g38b1

PDB Entry: 2g38, 2.2 Å

PDB Description: a pe/ppe protein complex from mycobacterium tuberculosis

PDB Compounds: (B:) ppe family protein

SCOP Domain Sequences for d2g38b1:

Sequence; same for both SEQRES and ATOM records:

>d2g38b1 a.25.4.2 (B:2-174) PPE41 {Mycobacterium tuberculosis [TaxId: 1773]}
afeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpvv
mqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqilid
nnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia

Timeline for d2g38b1:

• d2g38b1 is new in SCOP 1.73
  
• d2g38b1 appears in SCOP 1.75
  
• d2g38b1 appears in the current release, SCOPe 2.08