SCOPe 2.06: Domain d2g38a1: 2g38 A:8-84

Lineage for d2g38a1 (2g38 A:8-84)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.1: PE [140460] (2 proteins)
   Pfam PF00934; pairs with with the N-terminal hairpin of PPE

6. Protein PE25 [140461] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140462] (1 PDB entry)
   Uniprot Q7D756 8-84

8. Domain d2g38a1: 2g38 A:8-84 [134549]
   Other proteins in same PDB: d2g38b1, d2g38d_
   complexed with mn

Details for d2g38a1

PDB Entry: 2g38, 2.2 Å

PDB Description: a pe/ppe protein complex from mycobacterium tuberculosis

PDB Compounds: (A:) pe family protein

SCOPe Domain Sequences for d2g38a1:

Sequence; same for both SEQRES and ATOM records:

>d2g38a1 a.25.4.1 (A:8-84) PE25 {Mycobacterium tuberculosis [TaxId: 1773]}
pealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqtia
aaavvleefahalttga

Timeline for d2g38a1:

• d2g38a1 first appeared in SCOP 1.73
  
• d2g38a1 appears in SCOPe 2.05
  
• d2g38a1 appears in SCOPe 2.07
  
• d2g38a1 appears in the current release, SCOPe 2.08