Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Talin [82144] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries) |
Domain d2g35a1: 2g35 A:5-96 [134548] automatically matched to d1mixa2 |
PDB Entry: 2g35 (more details)
SCOPe Domain Sequences for d2g35a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g35a1 b.55.1.5 (A:5-96) Talin {Chicken (Gallus gallus) [TaxId: 9031]} gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl dfgdyqdgyysvqttegeqiaqliagyidiil
Timeline for d2g35a1: