Lineage for d2g35a1 (2g35 A:5-96)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071416Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2071466Protein Talin [82144] (1 species)
  7. 2071467Species Chicken (Gallus gallus) [TaxId:9031] [82145] (7 PDB entries)
  8. 2071471Domain d2g35a1: 2g35 A:5-96 [134548]
    automatically matched to d1mixa2

Details for d2g35a1

PDB Entry: 2g35 (more details)

PDB Description: nmr structure of talin-ptb in complex with pipki
PDB Compounds: (A:) Talin-1

SCOPe Domain Sequences for d2g35a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g35a1 b.55.1.5 (A:5-96) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

SCOPe Domain Coordinates for d2g35a1:

Click to download the PDB-style file with coordinates for d2g35a1.
(The format of our PDB-style files is described here.)

Timeline for d2g35a1: