![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily) beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet |
![]() | Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) ![]() |
![]() | Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins) |
![]() | Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries) |
![]() | Domain d2g30a2: 2g30 A:825-937 [134547] Other proteins in same PDB: d2g30a1 automatically matched to d1e42a2 |
PDB Entry: 2g30 (more details), 1.6 Å
SCOP Domain Sequences for d2g30a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g30a2 d.105.1.1 (A:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
Timeline for d2g30a2: