Lineage for d2g2xb2 (2g2x B:2-149)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824000Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
    Pfam PF01878; DUF55
  6. 2824021Protein automated matches [190653] (2 species)
    not a true protein
  7. 2824024Species Pseudomonas putida [TaxId:160488] [187732] (1 PDB entry)
  8. 2824025Domain d2g2xb2: 2g2x B:2-149 [134544]
    Other proteins in same PDB: d2g2xa1, d2g2xa2, d2g2xb3, d2g2xc3
    automated match to d2g2xa1
    complexed with so4

Details for d2g2xb2

PDB Entry: 2g2x (more details), 2.3 Å

PDB Description: X-Ray Crystal Structure Protein Q88CH6 from Pseudomonas putida. Northeast Structural Genomics Consortium Target PpR72.
PDB Compounds: (B:) hypothetical protein PP5205

SCOPe Domain Sequences for d2g2xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2xb2 b.122.1.8 (B:2-149) automated matches {Pseudomonas putida [TaxId: 160488]}
aywlmksepdelsiealarlgearwdgvrnyqarnflramsvgdefffyhsscpqpgiag
iaritraaypdptaldpeshyhdakattdknpwsavdvahvqtfprvlelgrlkqqaglv
elplvqkgsrlsvmpvtpeqwavivalr

SCOPe Domain Coordinates for d2g2xb2:

Click to download the PDB-style file with coordinates for d2g2xb2.
(The format of our PDB-style files is described here.)

Timeline for d2g2xb2: