Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins) Pfam PF01878; DUF55 |
Protein automated matches [190653] (2 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [187732] (1 PDB entry) |
Domain d2g2xb2: 2g2x B:2-149 [134544] Other proteins in same PDB: d2g2xa1, d2g2xa2, d2g2xb3, d2g2xc3 automated match to d2g2xa1 complexed with so4 |
PDB Entry: 2g2x (more details), 2.3 Å
SCOPe Domain Sequences for d2g2xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g2xb2 b.122.1.8 (B:2-149) automated matches {Pseudomonas putida [TaxId: 160488]} aywlmksepdelsiealarlgearwdgvrnyqarnflramsvgdefffyhsscpqpgiag iaritraaypdptaldpeshyhdakattdknpwsavdvahvqtfprvlelgrlkqqaglv elplvqkgsrlsvmpvtpeqwavivalr
Timeline for d2g2xb2:
View in 3D Domains from other chains: (mouse over for more information) d2g2xa1, d2g2xa2, d2g2xc2, d2g2xc3 |