SCOPe 2.08: Domain d2g2xa1: 2g2x A:2-149

Lineage for d2g2xa1 (2g2x A:2-149)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
   Pfam PF01878; DUF55

6. Protein Hypothetical protein PP5205 [141704] (1 species)

7. Species Pseudomonas putida kt2440 [TaxId:160488] [141705] (1 PDB entry)
   Uniprot Q88CH6 2-149

8. Domain d2g2xa1: 2g2x A:2-149 [134543]
   Other proteins in same PDB: d2g2xa2, d2g2xb2, d2g2xb3, d2g2xc2, d2g2xc3
   complexed with so4

Details for d2g2xa1

PDB Entry: 2g2x, 2.3 Å

PDB Description: X-Ray Crystal Structure Protein Q88CH6 from Pseudomonas putida. Northeast Structural Genomics Consortium Target PpR72.

PDB Compounds: (A:) hypothetical protein PP5205

SCOPe Domain Sequences for d2g2xa1:

Sequence; same for both SEQRES and ATOM records:

>d2g2xa1 b.122.1.8 (A:2-149) Hypothetical protein PP5205 {Pseudomonas putida kt2440 [TaxId: 160488]}
aywlmksepdelsiealarlgearwdgvrnyqarnflramsvgdefffyhsscpqpgiag
iaritraaypdptaldpeshyhdakattdknpwsavdvahvqtfprvlelgrlkqqaglv
elplvqkgsrlsvmpvtpeqwavivalr

Timeline for d2g2xa1:

• d2g2xa1 first appeared in SCOP 1.73
  
• d2g2xa1 appears in SCOPe 2.07