Lineage for d2g2jc1 (2g2j C:307-474)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831899Family c.37.1.19: Tandem AAA-ATPase domain [81268] (23 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 831900Protein ATP-dependent RNA helicase DDX25 [142310] (1 species)
  7. 831901Species Human (Homo sapiens) [TaxId:9606] [142311] (1 PDB entry)
    Uniprot Q9UHL0 307-474
  8. 831904Domain d2g2jc1: 2g2j C:307-474 [134538]
    automatically matched to 2G2J A:307-474
    complexed with so4

Details for d2g2jc1

PDB Entry: 2g2j (more details), 2.8 Å

PDB Description: Structure of the Helicase domain of the Human DDX25 RNA helicase
PDB Compounds: (C:) ATP-dependent RNA helicase DDX25

SCOP Domain Sequences for d2g2jc1:

Sequence, based on SEQRES records: (download)

>d2g2jc1 c.37.1.19 (C:307-474) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]}
ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs
llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvkqgeepdye
tylhrigrtgrfgkkglafnmievdelpslmkiqdhfnssikqlnaed

Sequence, based on observed residues (ATOM records): (download)

>d2g2jc1 c.37.1.19 (C:307-474) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]}
ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs
llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvpdyetylhr
igrtkglafnmievdelpslmkiqdhfnssikqlnaed

SCOP Domain Coordinates for d2g2jc1:

Click to download the PDB-style file with coordinates for d2g2jc1.
(The format of our PDB-style files is described here.)

Timeline for d2g2jc1: