SCOPe 2.06: Domain d2g2ca1: 2g2c A:1-163

Lineage for d2g2ca1 (2g2c A:1-163)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 proteins)

6. Protein Putative molybdenum cofactor biosynthesis protein DIP0503 [142543] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [142544] (1 PDB entry)
   Uniprot Q6NJA6 1-163

8. Domain d2g2ca1: 2g2c A:1-163 [134535]
   complexed with na

Details for d2g2ca1

PDB Entry: 2g2c, 1.5 Å

PDB Description: Putative molybdenum cofactor biosynthesis protein from Corynebacterium diphtheriae.

PDB Compounds: (A:) Putative molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d2g2ca1:

Sequence, based on SEQRES records:

>d2g2ca1 c.57.1.1 (A:1-163) Putative molybdenum cofactor biosynthesis protein DIP0503 {Corynebacterium diphtheriae [TaxId: 1717]}
mhiksaiivvsdristgtrenkalpllqrlmsdelqdysyelisevvvpegydtvveaia
talkqgarfiitaggtgiraknqtpeatasfihtrcegleqqilihgsththlaglsrgi
vgvtgrddhaalivnapsssggitdtwavispvipnifeglda

Sequence, based on observed residues (ATOM records):

>d2g2ca1 c.57.1.1 (A:1-163) Putative molybdenum cofactor biosynthesis protein DIP0503 {Corynebacterium diphtheriae [TaxId: 1717]}
mhiksaiivvsdristgtrenkalpllqrlmsdysyelisevvvpegydtvveaiatalk
qgarfiitaggtgiraknqtpeatasfihtrcegleqqilihgglsrgivgvtgrddhaa
livnapsssggitdtwavispvipnifeglda

Timeline for d2g2ca1:

• d2g2ca1 first appeared in SCOP 1.73
  
• d2g2ca1 appears in SCOPe 2.05
  
• d2g2ca1 appears in SCOPe 2.07
  
• d2g2ca1 appears in the current release, SCOPe 2.08