Lineage for d2g2ca1 (2g2c A:1-163)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127256Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2127257Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2127258Family c.57.1.1: MogA-like [53219] (6 protein domains)
  6. 2127327Protein Putative molybdenum cofactor biosynthesis protein DIP0503 [142543] (1 species)
  7. 2127328Species Corynebacterium diphtheriae [TaxId:1717] [142544] (1 PDB entry)
    Uniprot Q6NJA6 1-163
  8. 2127329Domain d2g2ca1: 2g2c A:1-163 [134535]
    complexed with na

Details for d2g2ca1

PDB Entry: 2g2c (more details), 1.5 Å

PDB Description: Putative molybdenum cofactor biosynthesis protein from Corynebacterium diphtheriae.
PDB Compounds: (A:) Putative molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d2g2ca1:

Sequence, based on SEQRES records: (download)

>d2g2ca1 c.57.1.1 (A:1-163) Putative molybdenum cofactor biosynthesis protein DIP0503 {Corynebacterium diphtheriae [TaxId: 1717]}
mhiksaiivvsdristgtrenkalpllqrlmsdelqdysyelisevvvpegydtvveaia
talkqgarfiitaggtgiraknqtpeatasfihtrcegleqqilihgsththlaglsrgi
vgvtgrddhaalivnapsssggitdtwavispvipnifeglda

Sequence, based on observed residues (ATOM records): (download)

>d2g2ca1 c.57.1.1 (A:1-163) Putative molybdenum cofactor biosynthesis protein DIP0503 {Corynebacterium diphtheriae [TaxId: 1717]}
mhiksaiivvsdristgtrenkalpllqrlmsdysyelisevvvpegydtvveaiatalk
qgarfiitaggtgiraknqtpeatasfihtrcegleqqilihgglsrgivgvtgrddhaa
livnapsssggitdtwavispvipnifeglda

SCOPe Domain Coordinates for d2g2ca1:

Click to download the PDB-style file with coordinates for d2g2ca1.
(The format of our PDB-style files is described here.)

Timeline for d2g2ca1: