Lineage for d2g28a1 (2g28 A:471-700)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986600Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 986601Protein Pyruvate dehydrogenase E1 component, Pyr module [88739] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 986602Species Escherichia coli [TaxId:562] [88740] (8 PDB entries)
  8. 986611Domain d2g28a1: 2g28 A:471-700 [134529]
    Other proteins in same PDB: d2g28a2, d2g28a3, d2g28b2, d2g28b3
    automatically matched to d1l8aa2
    complexed with mg, tdk

Details for d2g28a1

PDB Entry: 2g28 (more details), 1.85 Å

PDB Description: E. Coli Pyruvate Dehydrogenase H407A variant Phosphonolactylthiamin Diphosphate Complex
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d2g28a1:

Sequence, based on SEQRES records: (download)

>d2g28a1 c.36.1.6 (A:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records): (download)

>d2g28a1 c.36.1.6 (A:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

SCOPe Domain Coordinates for d2g28a1:

Click to download the PDB-style file with coordinates for d2g28a1.
(The format of our PDB-style files is described here.)

Timeline for d2g28a1: