SCOPe 2.05: Domain d2g25a2: 2g25 A:56-470

Lineage for d2g25a2 (2g25 A:56-470)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.10: TK-like PP module [88760] (3 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Pyruvate dehydrogenase E1 component, PP module [88764] (1 species)
   E1A and E1B fused together in a single-chain protein

7. Species Escherichia coli [TaxId:562] [88765] (8 PDB entries)

8. Domain d2g25a2: 2g25 A:56-470 [134524]
   Other proteins in same PDB: d2g25a1, d2g25a3, d2g25b1, d2g25b3
   automated match to d1l8aa1
   complexed with mg, po4, tdk

Details for d2g25a2

PDB Entry: 2g25, 2.1 Å

PDB Description: e. coli pyruvate dehydrogenase phosphonolactylthiamin diphosphate complex

PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d2g25a2:

Sequence; same for both SEQRES and ATOM records:

>d2g25a2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd
gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

Timeline for d2g25a2:

• d2g25a2 first appeared in SCOP 1.73
  
• d2g25a2 appears in SCOPe 2.04
  
• d2g25a2 appears in SCOPe 2.06
  
• d2g25a2 appears in the current release, SCOPe 2.08