Lineage for d2g25a2 (2g25 A:56-470)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 829218Family c.36.1.10: TK-like PP module [88760] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 829219Protein Pyruvate dehydrogenase E1 component, PP module [88764] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 829220Species Escherichia coli [TaxId:562] [88765] (8 PDB entries)
  8. 829233Domain d2g25a2: 2g25 A:56-470 [134524]
    Other proteins in same PDB: d2g25a1, d2g25a3, d2g25b1, d2g25b3
    automatically matched to d1l8aa1
    complexed with mg, po4, tdk

Details for d2g25a2

PDB Entry: 2g25 (more details), 2.1 Å

PDB Description: e. coli pyruvate dehydrogenase phosphonolactylthiamin diphosphate complex
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOP Domain Sequences for d2g25a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g25a2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd
gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

SCOP Domain Coordinates for d2g25a2:

Click to download the PDB-style file with coordinates for d2g25a2.
(The format of our PDB-style files is described here.)

Timeline for d2g25a2: