SCOPe 2.07: Domain d2g1la1: 2g1l A:498-599

Lineage for d2g1la1 (2g1l A:498-599)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein Kinesin-like protein kif1c [141137] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141138] (1 PDB entry)
   Uniprot O43896 498-599

8. Domain d2g1la1: 2g1l A:498-599 [134520]
   Other proteins in same PDB: d2g1la2
   complexed with cl, ni, unx

Details for d2g1la1

PDB Entry: 2g1l, 2.6 Å

PDB Description: crystal structure of the fha domain of human kinesin family member c

PDB Compounds: (A:) Kinesin-like protein KIF1C

SCOPe Domain Sequences for d2g1la1:

Sequence; same for both SEQRES and ATOM records:

>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]}
tphlvnlnedplmsecllyhikdgvtrvgqvdmdikltgqfireqhclfrsipqpdgevv
vtlepcegaetyvngklvteplvlksgnrivmgknhvfrfnh

Timeline for d2g1la1:

• d2g1la1 first appeared in SCOP 1.73
  
• d2g1la1 appears in SCOPe 2.06
  
• d2g1la1 appears in the current release, SCOPe 2.08