Lineage for d2g1la1 (2g1l A:498-599)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663035Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 663036Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) (S)
    has a few short helices inserted in loops
  5. 663070Family b.26.1.2: FHA domain [49885] (11 proteins)
  6. 663095Protein Kinesin-like protein kif1c [141137] (1 species)
  7. 663096Species Human (Homo sapiens) [TaxId:9606] [141138] (1 PDB entry)
  8. 663097Domain d2g1la1: 2g1l A:498-599 [134520]
    complexed with cl, ni, unx

Details for d2g1la1

PDB Entry: 2g1l (more details), 2.6 Å

PDB Description: crystal structure of the fha domain of human kinesin family member c
PDB Compounds: (A:) Kinesin-like protein KIF1C

SCOP Domain Sequences for d2g1la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]}
tphlvnlnedplmsecllyhikdgvtrvgqvdmdikltgqfireqhclfrsipqpdgevv
vtlepcegaetyvngklvteplvlksgnrivmgknhvfrfnh

SCOP Domain Coordinates for d2g1la1:

Click to download the PDB-style file with coordinates for d2g1la1.
(The format of our PDB-style files is described here.)

Timeline for d2g1la1: