Lineage for d2g1la1 (2g1l A:498-599)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778135Protein Kinesin-like protein kif1c [141137] (1 species)
  7. 2778136Species Human (Homo sapiens) [TaxId:9606] [141138] (1 PDB entry)
    Uniprot O43896 498-599
  8. 2778137Domain d2g1la1: 2g1l A:498-599 [134520]
    Other proteins in same PDB: d2g1la2
    complexed with cl, ni, unx

Details for d2g1la1

PDB Entry: 2g1l (more details), 2.6 Å

PDB Description: crystal structure of the fha domain of human kinesin family member c
PDB Compounds: (A:) Kinesin-like protein KIF1C

SCOPe Domain Sequences for d2g1la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]}
tphlvnlnedplmsecllyhikdgvtrvgqvdmdikltgqfireqhclfrsipqpdgevv
vtlepcegaetyvngklvteplvlksgnrivmgknhvfrfnh

SCOPe Domain Coordinates for d2g1la1:

Click to download the PDB-style file with coordinates for d2g1la1.
(The format of our PDB-style files is described here.)

Timeline for d2g1la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g1la2