Lineage for d2g1jb1 (2g1j B:2-166)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829750Family c.37.1.2: Shikimate kinase (AroK) [52566] (1 protein)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
  6. 829751Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 829765Species Mycobacterium tuberculosis [TaxId:1773] [75194] (19 PDB entries)
    Uniprot P95014
  8. 829780Domain d2g1jb1: 2g1j B:2-166 [134518]
    automatically matched to d1l4ua_
    complexed with so4

Details for d2g1jb1

PDB Entry: 2g1j (more details), 2 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis Shikimate Kinase at 2.0 angstrom resolution
PDB Compounds: (B:) Shikimate kinase

SCOP Domain Sequences for d2g1jb1:

Sequence, based on SEQRES records: (download)

>d2g1jb1 c.37.1.2 (B:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

Sequence, based on observed residues (ATOM records): (download)

>d2g1jb1 c.37.1.2 (B:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggagpdraek
yralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

SCOP Domain Coordinates for d2g1jb1:

Click to download the PDB-style file with coordinates for d2g1jb1.
(The format of our PDB-style files is described here.)

Timeline for d2g1jb1: